YAML Metadata
Warning:
empty or missing yaml metadata in repo card
(https://huggingface.co/docs/hub/model-cards#model-card-metadata)
ESM2 Protein Model
This is the protein component of a jointly trained NT-ESM2 model pair for DNA-protein analysis.
Model Details
- Model Type: ESM2 for protein sequences
- Training: Jointly trained with NT DNA model
- Architecture: Transformer-based language model for proteins
Usage
from transformers import AutoModel, AutoTokenizer
# Load model and tokenizer
model = AutoModel.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")
tokenizer = AutoTokenizer.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")
# Example usage
protein_sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
inputs = tokenizer(protein_sequence, return_tensors="pt")
outputs = model(**inputs)
Training Details
- Jointly trained with DNA sequences for cross-modal understanding
- Large model variant
- Transcript-specific protein coding sequences
Files
config.json: Model configurationmodel.safetensors: Model weightstokenizer_config.json: Tokenizer configurationvocab.txt: Vocabulary filespecial_tokens_map.json: Special tokens mapping
Citation
If you use this model, please cite the original ESM2 paper and your joint training work.
- Downloads last month
- -
Inference Providers
NEW
This model isn't deployed by any Inference Provider.
🙋
Ask for provider support